CAMPSQ1129
Title : Low-molecular cysteine-rich antifungal protein LCR77 , cysteine-rich antifungal protein At2g26020
GenInfo Identifier : 18202901
Source : Arabidopsis thaliana [Mouse-ear cress]
Taxonomy : Plantae
UniProt: Q9FI23 , O80994, Q9FI22
PubMed : 8989885
Activity : Antifungal
Target :
Alternaria brassicicola
Validated : Experimentally validated
InterPro : IPR008176 : Gamma-thionin.
IPR003614 : Scorpion_toxin-like.
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0006952 Biological process Defense response TAS
GO:0050832 Biological process Defense response to fungus IEA
GO:0009861 Biological process Jasmonic acid and ethylene-dependent systemic resistance TAS
GO:0031640 Biological process Killing of cells of other organism IEA
GO:0009723 Biological process Response to ethylene IEP
GO:0009625 Biological process Response to insect IEP
GO:0009753 Biological process Response to jasmonic acid IEP
GO:0005576 Cellular component Extracellular region IEA
GO:0006952 Biological process Defense response ISS
GO:0050832 Biological process Defense response to fungus IEA
GO:0031640 Biological process Killing of cells of other organism IEA
GO:0005576 Cellular component Extracellular region IEA
GO:0006952 Biological process Defense response ISS
GO:0050832 Biological process Defense response to fungus IEA
GO:0031640 Biological process Killing of cells of other organism IEA
GO:0005576 Biological process Extracellular region IEA
GO:0006952 Biological process Defense response ISS
GO:0050832 Biological process Defense response to fungus IEA
GO:0031640 Biological process Killing of cells of other organism IEA
GO:0005576 Biological process Extracellular region IEA
GO:0006952 Biological process Defense response ISS
GO:0050832 Biological process Defense response to fungus IEA
GO:0031640 Biological process Killing of cells of other organism IEA
GO:0005576 Biological process Extracellular region IEA
GO:0006952 Biological process Defense response TAS
GO:0050832 Biological process Defense response to fungus IEA
GO:0009861 Biological process Jasmonic acid and ethylene-dependent systemic resistance TAS
GO:0031640 Biological process Killing of cells of other organism IEA
GO:0009723 Biological process Response to ethylene IEP
GO:0009625 Biological process Response to insect IEP
GO:0009753 Biological process Response to jasmonic acid IEP
Length : 51
Sequence:
 QKLCEKPSGTWSGVCGNSNACKNQCINLEGAKHGSCNYVFPAHKCICYVPC

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India